PNC-27
32-amino acid chimeric anticancer peptide that targets membrane-localized HDM2/MDM2 on tumor cells, forming pores and triggering necrotic death in preclinical models.
FDA Warning (2017)
The FDA has warned cancer patients not to use PNC-27 products for treatment due to contamination findings and lack of established safety/efficacy. PNC-27 is for laboratory research only — no human use is endorsed or implied.
⚡ Executive Summary
PNC-27 is a research-only anticancer peptide that targets membrane-localized HDM2 (also called MDM2) on some tumor cells, forms pore-like complexes, and triggers necrotic death in preclinical models. It is not FDA-approved, lacks published human efficacy trials, and has drawn regulatory warnings about unapproved patient use. Reserve it strictly for laboratory research.
Jump to section
Overview
🧬 What is PNC-27?
PNC-27 is a 32-residue chimeric peptide that fuses the p53 transactivation segment (residues 12–26) to a cell-penetrating leader.
It binds HDM2/MDM2 in tumor-cell membranes and forms transmembrane pores that precipitate necrotic cell death.
🎯 Key Features
-
🔗
Membrane HDM2 binding — targets surface protein
-
🕳️
Pore formation — transmembrane complexes
-
💀
Necrotic death — rapid LDH release
Entity Properties
| Aliases | PNC-27, PNC27, p53(12–26)–penetratin/MRP chimera |
|---|---|
| Sequence |
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
|
| Length | 32 amino acids |
| Molecular Weight | ~4031 Da |
| CAS | Not assigned (research peptide) |
| Target | Membrane-localized HDM2/MDM2 |
| Diluent(s) | Sterile water, PBS; validate for your assay |
| Concentration | ~10–100 µg/mL (≈2.5–25 µM) in vitro |
| Storage | Lyophilized ≤ −20°C, desiccated, light-protected |
Mechanism of Action
🧠 How does PNC-27 work?
PNC-27 kills cancer cells by co-localizing with membrane HDM2 and assembling transmembrane pores, which rapidly compromise membrane integrity (LDH release) and can precede mitochondrial disruption.
The effect is p53-independent — it works on p53-null cells like K562 leukemia.
🔗 Step 1: Binding
p53(12–26) segment binds to HDM2 at residues 1–109 on tumor cell membrane surface
🕳️ Step 2: Pore Formation
PNC-27–HDM2 complexes assemble into transmembrane pore structures (visualized by immuno-EM)
💀 Step 3: Necrosis
Membrane integrity compromised → rapid LDH release → necrotic cell death within hours
Why membrane HDM2? HDM2/MDM2 is usually intracellular, but several groups report aberrant HDM2 at tumor plasma membranes, enabling extracellular targeting independent of p53 status.
Experimental Evidence
🔬 In Vitro / Preclinical Findings
Broad Cytotoxicity
Kills diverse tumor lines (pancreatic, melanoma, breast, ovarian, leukemia) while sparing normal cells
p53-Independent
Efficiently lyses K562 leukemia cells (p53-null), confirming membrane-targeted mechanism
Leukemia Models
U937, OCI-AML3, HL-60: LDH release within hours, reduced colony formation
Ovarian Cancer (ex vivo)
Primary cultures including chemoresistant subsets showed selective cytotoxicity
🔑 Key Takeaway
PNC-27 consistently shows HDM2-dependent, membrane-pore formation and necrotic killing of tumor cells in preclinical models — with relative sparing of normal cells — independent of tumor p53 status.
Limitations & Safety
🚨 Critical Limitations
-
✗
No FDA approval — explicitly warned patients not to use (2017)
-
✗
No human efficacy trials — no randomized or prospective data published
-
✗
Safety signals — case report of massive GI hemorrhage after experimental use abroad
-
✗
Limited reproducibility — substantial literature from limited set of laboratories
-
○
Generalizability — tumors without membrane HDM2 may be insensitive
Any use must remain laboratory-only. Broader, independent replications with standardized protocols are essential before any translational consideration.
Research Protocol Guidelines
Educational only. Designing a rigorous PNC-27 in-vitro study to test HDM2-dependent pore formation.
Select Models
Choose tumor lines with membrane HDM2 + matched normal cells + p53-null line (e.g., K562)
Verify Target
Confirm surface HDM2 by flow cytometry/immunostaining before dosing
Prepare Stocks
Reconstitute in sterile water/PBS; single-use aliquots; avoid freeze-thaw
Dose-Response
~10–100 µg/mL (≈2.5–25 µM); time points 0.5–24h for LDH release
Controls
Vehicle, PNC-29 (negative), anti-HDM2 blocking, nutlin (intracellular comparator)
Measure Outcomes
LDH release, viability assays, co-localization imaging, immuno-EM for pores
🎯 Information-Gain Framework
-
1️⃣
HDM2-Gate: Only proceed when surface HDM2 is verified
-
2️⃣
Pore-Proof: Pair LDH↑ with co-localization/pore imaging
-
3️⃣
Selectivity-Score: Quantify tumor vs. normal kill and relate to HDM2 levels
Comparison
Where does PNC-27 sit among membrane-active/peptide oncology approaches?
PNC-27
Targets surface HDM2 on tumor cells; pore-associated necrosis; spares normal cells lacking membrane HDM2.
LTX-315
Tumor-selective membranolysis with T-cell infiltration; converts “cold” to “hot” tumors.
p28 (azurin)
Non-lytic mechanism; enters cancer cells and stabilizes/activates p53 → apoptosis.
PNC-27 remains preclinical, whereas LTX-315 and p28 have Phase I human data (safety, pharmacodynamics), though neither is broadly approved for cancer treatment.
FAQ
Bottom line: PNC-27 is a research-only peptide with a compelling membrane-HDM2 pore-formation mechanism and selective tumor cytotoxicity in models—but without human efficacy data and under explicit FDA warnings. Design target-verified, control-rich experiments before inferring translational potential.